Target desc: NC_004718_SARS-human_Tor2_M_26398..27063_666bp_221aa JCMM | JCSG
Godzik Lab
BIMR
Crystallization class:  5 




Crystallization classes Help
1 Optimal
2 Suboptimal
3 Average
4 Difficult
5 Very difficult







Homologs (by PSI-BLAST)
Non-redundant NR database (NR60) 6
Solved strucutres (PDB) 0
 Comparison of target features with distributions of crystallization probabilities obtained from TargetDB Help
Protein features
Length221
Molecular weight 25063
Gravy index0.42
Isoelectic point9.63
Instability index30.46
Predictions
Transmembrane helices (number)3
Signal peptides (length)62
Longest disorder reg.4
Longest low complexity reg. 0
Coiled coils0
% disorder residues 2
% coil residues26
% helix residues 42
% strand residues 33
Other
Number of Cys residues 3
Number of Met residues 7
Number of Trp residues 7
Number of Tyr residues 9
Number of Phe residues 11
Epsilon 280 51910
Insertions score0.02
 1...*...10....*...20....*...30....*...40....*...50....*...60....*...70....*...80....*...90....*..100
MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFR

....*..110....*..120....*..130....*..140....*..150....*..160....*..170....*..180....*..190....*..200
LFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRI

....*..210....*..220.
GNYKLNTDHAGSNDNIALLVQ

Legend
LOOP loop secondary structure predicted by PSIPRED Download a file
HELIX helix secondary structure predicted by PSIPRED
STRAND strand secondary structure predicted by PSIPRED
DISORDER disordered region predicted by DISOPRED2 Download a file
LOW COMPLEXITY low complexity region predicted by SEG Download a file
COILS coiled coils region predicted by COILS Download a file
TRANSMEMBRANE HELICES transmembrane helices predicted by TMHMM Download a file
SIGNAL PEPTIDES signal peptites predicted by RPSP


Download
FASTA sequencetext file with protein sequence in FASTA format Download a file
Summarytext file with a summary of protein featuresDownload a file

About XtalPred | References | Contact Us | Pre-calculated Results

This server is supported by the NIH Protein Structure Initiative grants: P20 GM076221 (JCMM) and U54 GM074898 (JCSG).

Last update August 30, 2007