Target desc: NC_004718_SARS-human_Tor2_nsp1_265..804_540bp_180aa

JCMM | JCSG Godzik Lab BIMR

---

Crystallization class:  2  Crystallization classes 1 Optimal 2 Suboptimal 3 Average 4 Difficult 5 Very difficult Homologs (by PSI-BLAST) Non-redundant NR database (NR60) 1 Solved strucutres (PDB) 2

Comparison of target features with distributions of crystallization probabilities obtained from TargetDB

---

Protein features Length 180 Molecular weight 19642 Gravy index -0.36 Isoelectic point 5.35 Instability index 27.32 Predictions Transmembrane helices (number) No Signal peptides (length) No Longest disorder reg. 8 Longest low complexity reg. 0 Coiled coils 0 % disorder residues 11 % coil residues 39 % helix residues 33 % strand residues 27 Other Number of Cys residues 1 Number of Met residues 2 Number of Trp residues 1 Number of Tyr residues 6 Number of Phe residues 2 Epsilon 280 14440 Insertions score -1.00

1...*...10....*...20....*...30....*...40....*...50....*...60....*...70....*...80....*...90....*..100 MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRS ....*..110....*..120....*..130....*..140....*..150....*..160....*..170....*..180 GITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGG Legend LOOP loop secondary structure predicted by PSIPRED HELIX helix secondary structure predicted by PSIPRED STRAND strand secondary structure predicted by PSIPRED DISORDER disordered region predicted by DISOPRED2 LOW COMPLEXITY low complexity region predicted by SEG COILS coiled coils region predicted by COILS TRANSMEMBRANE HELICES transmembrane helices predicted by TMHMM SIGNAL PEPTIDES signal peptites predicted by RPSP Download FASTA sequence text file with protein sequence in FASTA format Summary text file with a summary of protein features

---

About XtalPred | References | Contact Us | Pre-calculated Results

This server is supported by the NIH Protein Structure Initiative grants: P20 GM076221 (JCMM) and U54 GM074898 (JCSG).

Last update August 30, 2007