Target desc: NC_004718_SARS-human_Tor2_nsp5_9985..10902_918bp_306aa JCMM | JCSG
Godzik Lab
BIMR
Crystallization class:  1 




Crystallization classes Help
1 Optimal
2 Suboptimal
3 Average
4 Difficult
5 Very difficult







Homologs (by PSI-BLAST)
Non-redundant NR database (NR60) 8
Solved strucutres (PDB) 28
 Comparison of target features with distributions of crystallization probabilities obtained from TargetDB Help
Protein features
Length306
Molecular weight 33850
Gravy index-0.05
Isoelectic point6.22
Instability index29.67
Predictions
Transmembrane helices (number)No
Signal peptides (length)No
Longest disorder reg.7
Longest low complexity reg. 0
Coiled coils0
% disorder residues 3
% coil residues38
% helix residues 19
% strand residues 43
Other
Number of Cys residues 12
Number of Met residues 10
Number of Trp residues 3
Number of Tyr residues 11
Number of Phe residues 16
Epsilon 280 32890
Insertions score0.06
 1...*...10....*...20....*...30....*...40....*...50....*...60....*...70....*...80....*...90....*..100
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK

....*..110....*..120....*..130....*..140....*..150....*..160....*..170....*..180....*..190....*..200
YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI

....*..210....*..220....*..230....*..240....*..250....*..260....*..270....*..280....*..290....*..300
TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC

....*.
SGVTFQ

Legend
LOOP loop secondary structure predicted by PSIPRED Download a file
HELIX helix secondary structure predicted by PSIPRED
STRAND strand secondary structure predicted by PSIPRED
DISORDER disordered region predicted by DISOPRED2 Download a file
LOW COMPLEXITY low complexity region predicted by SEG Download a file
COILS coiled coils region predicted by COILS Download a file
TRANSMEMBRANE HELICES transmembrane helices predicted by TMHMM Download a file
SIGNAL PEPTIDES signal peptites predicted by RPSP


Download
FASTA sequencetext file with protein sequence in FASTA format Download a file
Summarytext file with a summary of protein featuresDownload a file

About XtalPred | References | Contact Us | Pre-calculated Results

This server is supported by the NIH Protein Structure Initiative grants: P20 GM076221 (JCMM) and U54 GM074898 (JCSG).

Last update August 30, 2007