Target desc: NC_004718_SARS-human_Tor2_nsp9_12616..12954_339bp_113aa JCMM | JCSG
Godzik Lab
BIMR

Crystallization class:  3 




Crystallization classes Help
1 Optimal
2 Suboptimal
3 Average
4 Difficult
5 Very difficult







Homologs (by PSI-BLAST)
Non-redundant NR database (NR60) 8
Solved strucutres (PDB) 2
Comparison of target features with distributions of crystallization probabilities obtained from TargetDB Help

Protein features
Length113
Molecular weight 12402
Gravy index-0.31
Isoelectic point9.10
Instability index32.03
Predictions
Transmembrane helices (number)No
Signal peptides (length)No
Longest disorder reg.6
Longest low complexity reg. 0
Coiled coils0
% disorder residues 5
% coil residues41
% helix residues 4
% strand residues 56
Other
Number of Cys residues 3
Number of Met residues 2
Number of Trp residues 1
Number of Tyr residues 5
Number of Phe residues 4
Epsilon 280 12950
Insertions score0.10
1...*...10....*...20....*...30....*...40....*...50....*...60....*...70....*...80....*...90....*..100
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRG

....*..110...
MVLGSLAATVRLQ

Legend
LOOP loop secondary structure predicted by PSIPRED Download a file
HELIX helix secondary structure predicted by PSIPRED
STRAND strand secondary structure predicted by PSIPRED
DISORDER disordered region predicted by DISOPRED2 Download a file
LOW COMPLEXITY low complexity region predicted by SEG Download a file
COILS coiled coils region predicted by COILS Download a file
TRANSMEMBRANE HELICES transmembrane helices predicted by TMHMM Download a file
SIGNAL PEPTIDES signal peptites predicted by RPSP


Download
FASTA sequencetext file with protein sequence in FASTA format Download a file
Summarytext file with a summary of protein featuresDownload a file


About XtalPred | References | Contact Us | Pre-calculated Results

This server is supported by the NIH Protein Structure Initiative grants: P20 GM076221 (JCMM) and U54 GM074898 (JCSG).

Last update August 30, 2007